PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G030100.2
Common NamePHAVU_006G030100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HB-other
Protein Properties Length: 479aa    MW: 54127.9 Da    PI: 6.7512
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G030100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.9e-182075257
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        +kR+  t+ ql++Le +++ ++yp++e++ eLA++l+Lte+q++ WF+ rR k+kk
  Phvul.006G030100.2 20 KKRRLKTPAQLTALEIFYNDHKYPTEEMKSELAEELELTEKQISGWFCHRRLKDKK 75
                        89****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-20275IPR009057Homeodomain-like
SuperFamilySSF466892.91E-161679IPR009057Homeodomain-like
PROSITE profilePS5007116.6011676IPR001356Homeobox domain
SMARTSM003893.2E-181880IPR001356Homeobox domain
PfamPF000466.7E-162075IPR001356Homeobox domain
CDDcd000867.23E-82075No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MEEATEMQSE ENKLSMEKNK KRRLKTPAQL TALEIFYNDH KYPTEEMKSE LAEELELTEK  60
QISGWFCHRR LKDKKLLNDE VGANGRQDRS SGVIQDRGSG LVQDSCGSTK HGDYRYLDPK  120
EVESHGLYNH EFSAADMTYH RNHHYTENDS ATDNTSSESC SSLQDPLLPQ GQDPYDMEPS  180
SHLMPNRSLP PLNPKGANNM GYKPSGYLKV KGEIEHVAIT AVKKQLGNHF QEDGPLLSVE  240
FDTIPPGAFE GQLTDLANEG YYAANSALPN SPEVSAAKKL SSSSRYDSYF TKLRFQDSHM  300
EGGDFGSLHG PDFQDKKPHK HINQRPTFHS FTNHFSHKNS SLDFYVDSTG EASAYNGAKK  360
HRMGTKHGFE GMRSDSASNP SDHYEENTLA VKQIDSLLHL YDNINLKNVQ KNEYVKSKPS  420
NSIHKSQIYL NAEEKGLTKR MAKEEKFNGD RKLKRHYHDP DGIRVLSNEK MVCCRDAI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11924KKRRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146315.10.0hypothetical protein PHAVU_006G030100g
TrEMBLV7BJZ40.0V7BJZ4_PHAVU; Uncharacterized protein
STRINGGLYMA18G14910.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.12e-65HB-other family protein